Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

World Whiskey Society Launches 20-Year-Old Family Reserve Whiskey

PRESS RELEASE posted by World Whiskey Society

Dec. 20, 2024 at 10:39 am

XLinkedInRedditFacebookEmail
Report Press Release
worldwhiskeysocietywhiskeyfamilyreservenewrelease
Spirits Companies
  • image-01

New York, NY - December 20, 2024 - World Whiskey Society (WWS), known for scouring the globe to create the world’s most interesting whiskeys, is proud to announce its latest release: a 20-year-old Family Reserve cask-proof whiskey. 

As AIKO Brands celebrates its 20th anniversary, they reflect on the extraordinary journey that has brought them here – a journey defined by craftsmanship, connection, and the enduring support of a loyal community of wine and spirits enthusiasts. Over two decades, AIKO Brands has grown into a symbol of passion and excellence, uniting people around the world with exceptional wine and spirits.

This year, they’re marking this milestone with something truly extraordinary: the release of the Family Reserve, a whiskey that encapsulates the very essence of their heritage. Aged for 20 years, it is a rare and remarkable spirit crafted to honor the past, celebrate the present, and inspire the future.

“This special Family Reserve release is a tribute to our father, Igor Kogan, inspired by his vision to create something timeless and beautiful – something that brings people together to celebrate life’s most precious moments. This release is more than just whiskey; it’s a story of transformation, growth, and the relentless pursuit of excellence” says Alex and Irina Kogan, Founders of World Whiskey Society. "As we raise our glasses to two decades of AIKO Brands, we invite you to celebrate with us — honoring the past, savoring the present, and toasting to the future.” adds Feliks Shekhtman, Aiko Brands Managing Partner. “Here's to the next 20 years of shared stories, laughter, and extraordinary whisky." 

The Family Reserve is not just a whiskey; it’s a heartfelt tribute to Igor Kogan, the visionary behind AIKO Brands. Born in Kiev, Ukraine, Igor was a man of remarkable talent and unyielding determination. A colonel in the Army, an educator, inventor, poet, musician, PhD, and later a college professor and entrepreneur in the United States, Igor’s life was defined by creativity, intellect, and resilience.

Igor’s dedication to building a strong family legacy and his belief that success can only be achieved through hard work formed the foundation upon which AIKO Brands was established and instilled that passion and values that are being carried on today through his daughter, Irina Kogan, son, Alex Kogan, and son-in-law, Feliks Shekhtman

The Family Reserve is a testament to the art of craftsmanship and mastery. Distilled at a renowned Kentucky distillery, the Family Reserve Cask Proof has been aged for 20 years with a Mash Bill of 74% Corn, 18% Rye, and 8% Malted Barley. A well-aged, luxurious dram with a harmonious balance of fruit, oak, and spice, all elevated by the nuances of roasted peanuts and butterscotch yielding exceptional depth and refinement.

This limited edition release is now available on WWS online shop and at select retailers nationwide for $1,500. For more information about WWS and its exceptional range of rare whiskeys, including this latest release, please visit the World Whiskey Society website.  

To honor Igor’s memory and his unwavering dedication to creating beauty in all things, 100% of the proceeds from the Family Reserve release will be donated to the Lustgarten Foundation. This organization is at the forefront of research and studies on pancreatic cancer, offering hope and advancing treatment for those impacted by this devastating disease.

About World Whiskey Society:

Established in 2020, the World Whiskey Society (WWS) comprises an ultra-premium collection of rare expressions previously unavailable to even the most sophisticated whiskey enthusiasts. WWS scours the globe far and wide with a singular goal in mind – uniqueness – before selecting a distillery partner to join WWS. Or they may choose to release something completely new by finishing small-batch American bourbon in exotic oak barrels from Japan. Whether it is the Classic Collection, the Reserve Collection, the tributes to Doc Holliday, or the Diamond Collection, WWS offers whiskies for everyday enjoyment and moments of celebration.

Media Contact: Sam O’Brien, Colangelo & Partners

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Manufacturing & Packaging Services - Portland, Maine Area

Contract Manufacturing & Packaging Services - Port...

View All|Post a Listing

Featured Jobs

Area Sales Manager - New Jersey - Good Boy Vodka

Area Sales Manager - New Jersey - Good Boy Vodka

Office & Logistics Administrator - Garage Brewing Co

Office & Logistics Administrator - Garage Brewing ...

Account Manager - Spikedade

Account Manager - Spikedade

Sales Executives wanted for Beer/Wine/ Liquor store channels in the South East - Club13 Herbals

Sales Executives wanted for Beer/Wine/ Liquor stor...

Head Brewer - North Country Brewing Co

Head Brewer - North Country Brewing Co

Sales Represenative - Bluebird Hardwater

Sales Represenative - Bluebird Hardwater

View All Jobs|Post a Job

More News

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

Medici Brands Raises $250M To Scale David Protein, HallPass

Medici Brands Raises $250M To Scale David Protein, HallPass

Nestlé Offloads NUUN Amid Supplement Divestment

Nestlé Offloads NUUN Amid Supplement Divestment

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer - North Country Brewing Co - North Country Brewing Co
  • Director of Key Accounts & Distribution - West - CLEAN Cause - CLEAN Cause
  • Sr Sales Manager - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Shift Brewer - Black Hog Brewing - Black Hog Brewing
  • Area Sales Manager - Louisville & Tampa/St. Pete - Beverage Capital Group - Beverage Capital Group
  • Sales Specialist - North Carolina - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Austin TX - Trade Marketing Manager - DioniLife USA - DioniLife USA
View AllPost a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. BevNET’s 2026 Natural Beverage Showcase Is Now Available in Two Formats
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  4. Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita
  5. Martignetti to Acquire Red Network Distributor Girardi in Massachusetts
  6. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  7. Medici Brands Raises $250M To Scale David Protein, HallPass
  1. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  2. Flying High: Drippy Bringing THC Drinks to the Skies With Virgin Airlines
  3. Join Us at BevNET Live December 7-9 in Marina del Rey, CA; Register Early to Save
  4. A Drink With… Little Saints’ Megan Klein
  5. BevNET Launches New Press Release Portal
  6. Country Star Niko Moon Launches Happy Himalayan Premium Artesian Water on Earth Day
  7. National Shag Dance Champions Launch Shag-a-Rita
  1. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  2. RTD Cocktails: New Releases From Salt Point, Deep Eddy, Freixenet and More
  3. Crooked Pop Taps Former Zevia Exec Lee Schill as CCO
  4. Morales Beverage Group Moves In On RNDC Indiana Assets
  5. Finnish Long Drink Cuts Sales Roles After Mark Anthony Acquisition
  6. Pernod Ricard Leans Into RTDs as It Navigates a Down Year
  7. Verlaine’s Lychee Martini Tests 25 Years Of NYC Bar Cred As It Breaks Into New Markets
  1. FIFCO USA Acquired by Former CEO’s Private Equity Group
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. A Virtual Walk Through 40 Years of Alaskan Brewing & Its Celebratory 40-Pack
  4. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  5. Brewbound Podcast: Hard Sports Drinks, Industry Layoffs and Pabst’s Stolen Beer
  6. ‘Stagnant’ Off-Premise Bev-Alc Sales Cause Déjà Vu in Weekly NIQ Scans
  7. Press Clips: Press Hard Seltzer Sold, Diageo’s NYC Job Cuts and Sam Adams’ Inflatable Beer Hall
View All|Submit News

Promoted PR Posts

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

ROAR Organic Appoints William Meissner as President

ROAR Organic Appoints William Meissner as President

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase