Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

B.R. Distilling Company Launches Limited-Release Blue Note Special Reserve

PRESS RELEASE posted by Blue Note Bourbon

Feb. 10, 2025 at 10:39 am

XLinkedInRedditFacebookEmail
Report Press Release
bourbonbourbonwhiskeybluenotebourbonspecialreservecaskfinishedserieslimitedrelease
Spirits Companies
  • image-01

Blend of Straight Bourbon Whiskeys Finished in 10 Different Casks is the Latest Expression in the Company’s Cask Finished Series

Memphis, TN (February 10, 2025) – Blue Note Bourbon™, the award-winning whiskey portfolio which is artfully crafted to honor the rich blues music that is synonymous with Memphis, has launched its second-annual Special Reserve Straight Bourbon Whiskey.

Crafted in Memphis, the limited-release is a blend of 10 casks from Kentucky and Tennessee – cognac, madeira, sherry, port, triple sec, madeira, apricot brandy, amontillado, vanilla cognac and vino de Naranja – ranging in age from four to 19 years with varying mashbills. The new expression was bottled at 116.3 proof (58.15% ABV), unfiltered.

Special Reserve Tasting Notes

·       Nose: Bright fruit, cherry, peach, leather, oak and vanilla

·       Palate: Creamy and light, oak, vanilla, roasted nuts, dark chocolate, and citrus

·       Finish: Light warmth with a chewy, slightly dry texture that lingers

In addition to last year’s Special Reserve, Blue Note has introduced several other highly awarded limited-release offerings, which include Premium Small Batch, Single Barrel Reserve, 17-year, and most recently a Honey Rye and Honey Bourbon Cask.

“Having launched several wildly successful limited releases in recent years, whiskey enthusiasts have come to expect these types of unique offerings from Blue Note,” said Chris Crosbie, Vice President, Sales, B.R. Distilling Company. “This year’s Special Reserve is both exceptional and uncommon having been crafted from 10 unique types of casks.”

Approximately 2,000 bottles of Blue Note Special Reserve are now available for purchase online at BlueNoteBourbon.com and in 20 U.S. states (as listed below). The suggested retail price for a 750ml bottle is $225.

Blue Note’s whiskey portfolio is distilled in partnership with Bardstown Bourbon Company (parent company of Green River Distilling) and then aged just north of downtown Memphis where the Mississippi and Wolf Rivers collide. The long summers filled with infamous Memphis heat and cooler evenings forces the whiskey deep into the oak, creating an unmistakably rich flavor that’s bold yet smooth.

In addition to the aforementioned limited releases, award-winning flagship Blue Note portfolio includes Juke Joint ($34.99), Crossroads ($44.99), Uncut ($49.99), and Straight Rye Whiskey ($34.99). At the 2024 San Francisco World Spirits Competition, Juke Joint and Crossroads were awarded Platinum medals, a rare honor meaning that each expression has received Double Gold medals for three consecutive years.

Production Facility & Tasting Room

Blue Note’s 110,000 square foot production facilities, located on Royal Avenue just North of downtown Memphis, are open from Monday through Friday from 10am – 4:00pm CST and include a unique and intimate tasting room. Guided tours are available on Thursdays and Fridays for $10 plus tax & fees. Guests can add a Tasting Flight Experience for an additional $5. Please follow Blue Note on Facebook and Instagram.

About B.R. Distilling Company

Founded in 2014 in Memphis, TN, B.R. Distilling Company is the oldest licensed distillery in Memphis, TN, and producer of world-famous Blue Note Bourbon. Currently, the company produces four flagship expressions, along with regular limited releases, which are distributed across 20 U.S. states, including AL, AR, CO, CT, FL, GA, KS, KY, LA, MA, MI, MS, MO, NY, NJ, OK, RI, SC, TN, and TX, and online at BlueNoteBourbon.com via Bevstack, which can be shipped to: AZ, CA, CO, CT, DE, FL, GA, IA, ID, IL, IN, KS, KY, MD, MN, MO, NC, ND, NE, NH, NJ, NM, NV, NY, OH, OK, OR, PA, RI, TX, VA, WA and WI. Take note. Sip responsibly.

# # #

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Manufacturing & Packaging Services - Portland, Maine Area

Contract Manufacturing & Packaging Services - Port...

View All|Post a Listing

Featured Jobs

Area Sales Manager - New Jersey - Good Boy Vodka

Area Sales Manager - New Jersey - Good Boy Vodka

Office & Logistics Administrator - Garage Brewing Co

Office & Logistics Administrator - Garage Brewing ...

Account Manager - Spikedade

Account Manager - Spikedade

Sales Executives wanted for Beer/Wine/ Liquor store channels in the South East - Club13 Herbals

Sales Executives wanted for Beer/Wine/ Liquor stor...

Head Brewer - North Country Brewing Co

Head Brewer - North Country Brewing Co

Sales Represenative - Bluebird Hardwater

Sales Represenative - Bluebird Hardwater

View All Jobs|Post a Job

More News

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

Medici Brands Raises $250M To Scale David Protein, HallPass

Medici Brands Raises $250M To Scale David Protein, HallPass

Nestlé Offloads NUUN Amid Supplement Divestment

Nestlé Offloads NUUN Amid Supplement Divestment

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer - North Country Brewing Co - North Country Brewing Co
  • Director of Key Accounts & Distribution - West - CLEAN Cause - CLEAN Cause
  • Sr Sales Manager - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Shift Brewer - Black Hog Brewing - Black Hog Brewing
  • Area Sales Manager - Louisville & Tampa/St. Pete - Beverage Capital Group - Beverage Capital Group
  • Sales Specialist - North Carolina - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Austin TX - Trade Marketing Manager - DioniLife USA - DioniLife USA
View AllPost a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. BevNET’s 2026 Natural Beverage Showcase Is Now Available in Two Formats
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  4. Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita
  5. Martignetti to Acquire Red Network Distributor Girardi in Massachusetts
  6. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  7. Medici Brands Raises $250M To Scale David Protein, HallPass
  1. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  2. Flying High: Drippy Bringing THC Drinks to the Skies With Virgin Airlines
  3. Join Us at BevNET Live December 7-9 in Marina del Rey, CA; Register Early to Save
  4. A Drink With… Little Saints’ Megan Klein
  5. BevNET Launches New Press Release Portal
  6. Country Star Niko Moon Launches Happy Himalayan Premium Artesian Water on Earth Day
  7. National Shag Dance Champions Launch Shag-a-Rita
  1. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  2. RTD Cocktails: New Releases From Salt Point, Deep Eddy, Freixenet and More
  3. Crooked Pop Taps Former Zevia Exec Lee Schill as CCO
  4. Morales Beverage Group Moves In On RNDC Indiana Assets
  5. Finnish Long Drink Cuts Sales Roles After Mark Anthony Acquisition
  6. Pernod Ricard Leans Into RTDs as It Navigates a Down Year
  7. Verlaine’s Lychee Martini Tests 25 Years Of NYC Bar Cred As It Breaks Into New Markets
  1. FIFCO USA Acquired by Former CEO’s Private Equity Group
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. A Virtual Walk Through 40 Years of Alaskan Brewing & Its Celebratory 40-Pack
  4. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  5. Brewbound Podcast: Hard Sports Drinks, Industry Layoffs and Pabst’s Stolen Beer
  6. ‘Stagnant’ Off-Premise Bev-Alc Sales Cause Déjà Vu in Weekly NIQ Scans
  7. Press Clips: Press Hard Seltzer Sold, Diageo’s NYC Job Cuts and Sam Adams’ Inflatable Beer Hall
View All|Submit News

Promoted PR Posts

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

ROAR Organic Appoints William Meissner as President

ROAR Organic Appoints William Meissner as President

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase