Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Crown Royal Unveils Crown Royal Marquis: A Bold New Whisky Crafted For The Next Era Of Nightlife

PRESS RELEASE posted by Crown Royal

Apr. 30, 2025 at 1:30 pm

XLinkedInRedditFacebookEmail
Report Press Release
crown royalwhiskywhiskeydrinksspiritsliquor
Spirits Companies
  • image-01
NEW YORK, April 30, 2025 /PRNewswire/ -- Crown Royal announces the release of Crown Royal Marquis Blended Canadian Whisky, the latest innovation in its award-winning portfolio. Finished in Caribbean rum casks and aged to perfection, this distinctive blend is crafted for moments that start as a typical night out and turn unforgettable, reflecting the brand's commitment to crafting exceptional whisky for every occasion.

With rich, inviting notes of honey, brown sugar, and vanilla, and delightful hints of date and fig that give way to a smooth finish, Crown Royal Marquis delivers a complex and versatile flavor. This innovation is crafted for the moments we all crave- the ones that start at the bar and end up on the dance floor sparking spontaneous connections over, live music and good vibes. Whether it's cocktails over dinner that turn into dancing, brunch that becomes a day party or a casual night out that leads to the city's hottest after-parties, Crown Royal Marquis is about celebrating the return of nightlife liveliness.

"Crown Royal Marquis is a very special innovation for the brand, one that truly brings to life our goal of creating exceptional whiskies for every occasion," said Hadley Schafer, VP of Crown Royal. "It's layered flavors and strikingly unique bottle were crafted with everyday royalty in mind, consumers (+21) can enjoy a spirit that makes a delicious cocktail and represents that inviting energy we want to see again in nightlife culture."

To celebrate the debut, Crown Royal Marquis is popping up at Washington DC, and Atlanta's most high-energy events, inviting consumers 21+ to reignite nightlife over bright, elevated cocktails. The liquid is an exceptional expression made to complement the occasions that become Crown Royal Maquis moments. Crown Royal Marquis can be enjoyed neat, on the rocks, or paired with pineapple juice in one of their signature, easy to make cocktails – the Crown Royal Marquis Moment or the Marquis Daquiri.

The Marquis Daiquiri

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky1 oz Pineapple Juice.5 oz Lime Juice.5 oz Simple Syrup

Directions: Add all ingredients into a cocktail shaker and shake vigorously. Strain into a coupe glass and top with dehydrated lime wheel garnish

The Crown Royal Marquis Moment

Ingredients: 1.5 oz Crown Royal Marquis Blended Canadian Whisky3 oz Pineapple JuiceTop of Club SodaSplash of Lime

Directions: Add all ingredients into a cocktail shaker, add ice. Shake and strain into an ice-filled rocks glass and garnish with dehydrated pineapple.

The Crown Royal Marquis bottle maintains the brands iconic shape, reimagined with luxurious detail. A deep, purple hue paired with signature Crown Royal purple lettering gives the bottle a sleek, elevated finish that mirrors the whisky's bold character. It's a refined take on a classic design, fit for gifting, celebrating or standing out on the shelf.

Crown Royal Marquis will be available beginning May 2025 in Georgia, Maryland, Washington D.C. and select military bases, where spirits-based beverages are sold, for a suggested retail price of $39.99.

For more information about Crown Royal Marquis and to explore the full Crown Royal portfolio, please visit crownroyal.com.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Manufacturing & Packaging Services - Portland, Maine Area

Contract Manufacturing & Packaging Services - Port...

View All|Post a Listing

Featured Jobs

Area Sales Manager - New Jersey - Good Boy Vodka

Area Sales Manager - New Jersey - Good Boy Vodka

Office & Logistics Administrator - Garage Brewing Co

Office & Logistics Administrator - Garage Brewing ...

Account Manager - Spikedade

Account Manager - Spikedade

Sales Executives wanted for Beer/Wine/ Liquor store channels in the South East - Club13 Herbals

Sales Executives wanted for Beer/Wine/ Liquor stor...

Head Brewer - North Country Brewing Co

Head Brewer - North Country Brewing Co

Sales Represenative - Bluebird Hardwater

Sales Represenative - Bluebird Hardwater

View All Jobs|Post a Job

More News

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

Martignetti to Acquire Red Network Distributor Girardi in Massachusetts

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink

Medici Brands Raises $250M To Scale David Protein, HallPass

Medici Brands Raises $250M To Scale David Protein, HallPass

Nestlé Offloads NUUN Amid Supplement Divestment

Nestlé Offloads NUUN Amid Supplement Divestment

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer - North Country Brewing Co - North Country Brewing Co
  • Director of Key Accounts & Distribution - West - CLEAN Cause - CLEAN Cause
  • Sr Sales Manager - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Shift Brewer - Black Hog Brewing - Black Hog Brewing
  • Area Sales Manager - Louisville & Tampa/St. Pete - Beverage Capital Group - Beverage Capital Group
  • Sales Specialist - North Carolina - Creature Comforts Brewing Company - Creature Comforts Brewing Company
  • Austin TX - Trade Marketing Manager - DioniLife USA - DioniLife USA
View AllPost a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. BevNET’s 2026 Natural Beverage Showcase Is Now Available in Two Formats
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  4. Review: Mission Craft Cocktails Might Have Made the Perfect Pickle-Rita
  5. Martignetti to Acquire Red Network Distributor Girardi in Massachusetts
  6. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  7. Medici Brands Raises $250M To Scale David Protein, HallPass
  1. How Low Can You Go? Herb Light Makes Its Case for Light Beer-Inspired, 1MG THC Drink
  2. Flying High: Drippy Bringing THC Drinks to the Skies With Virgin Airlines
  3. Join Us at BevNET Live December 7-9 in Marina del Rey, CA; Register Early to Save
  4. A Drink With… Little Saints’ Megan Klein
  5. BevNET Launches New Press Release Portal
  6. Country Star Niko Moon Launches Happy Himalayan Premium Artesian Water on Earth Day
  7. National Shag Dance Champions Launch Shag-a-Rita
  1. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  2. RTD Cocktails: New Releases From Salt Point, Deep Eddy, Freixenet and More
  3. Crooked Pop Taps Former Zevia Exec Lee Schill as CCO
  4. Morales Beverage Group Moves In On RNDC Indiana Assets
  5. Finnish Long Drink Cuts Sales Roles After Mark Anthony Acquisition
  6. Pernod Ricard Leans Into RTDs as It Navigates a Down Year
  7. Verlaine’s Lychee Martini Tests 25 Years Of NYC Bar Cred As It Breaks Into New Markets
  1. FIFCO USA Acquired by Former CEO’s Private Equity Group
  2. The Next High: Kava, Kanna Eye Opportunity Amid Hemp THC Uncertainty
  3. A Virtual Walk Through 40 Years of Alaskan Brewing & Its Celebratory 40-Pack
  4. Liquid Death Founder and Sazerac Launch Mr. Fancy Canned ‘American Bubbly’
  5. Brewbound Podcast: Hard Sports Drinks, Industry Layoffs and Pabst’s Stolen Beer
  6. ‘Stagnant’ Off-Premise Bev-Alc Sales Cause Déjà Vu in Weekly NIQ Scans
  7. Press Clips: Press Hard Seltzer Sold, Diageo’s NYC Job Cuts and Sam Adams’ Inflatable Beer Hall
View All|Submit News

Promoted PR Posts

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

Wild Bill's Brings Fan-Favorite Sparkling Lemonade from the Midway to Store Shelves

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

UltraPhil Launches Program to Help Beverage Startups Accelerate Commercialization

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

NO CAP! Soda Pop and SOUR PUNCH Announce Licensing Partnership Bringing Iconic Candy Flavors to Better-for-You Soda

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

The Curated, Smarter-Sipping Bottle Shop to Open Second Location in LA

ROAR Organic Appoints William Meissner as President

ROAR Organic Appoints William Meissner as President

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

NO CAP! Soda Pop Sweeps X Games: A Complete 360 Activation

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase