Skip to main content
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
  • CPG Jobs
  • Newsletter
  • Join Slack
  • Podcasts
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live LA: Dec. 6-8
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • BevNET Best of 2026 Awards
      Submit Your Nominations
    • BevNET 2026 Spirits Awards
      Submit Your Nominations
    • Annual CPG Awards
    • Submit Product
      Add Your Product to Our Free Database
    • Industry Showcase Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2025 Industry Awards
    • Industry Showcases
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: Dec. 6-8
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Fettercairn Whisky Opens a New Chapter in the U.S., Inviting Discovery Through Its Core Range of Tropical Single Malts

PRESS RELEASE posted by Cork + Knife Communications

Apr. 14, 2026 at 1:29 pm

XLinkedInRedditFacebookEmail
Report Press Release
scotchsingle maltwhiskeywhiskyfettercairntropicalluxuryspiritpremium
Spirits CompaniesFood Companies
  • image-01

Featuring the 12- and 16-Year-Old expressions, offering curious whisky lovers and connoisseurs a new dimension of flavor through Fettercairn’s signature house style

NEW YORK, NY | Fettercairn Single Malt Scotch Whisky is one of the whisky world’s most coveted hidden gems – a Highland distillery prized for its rare, aged, and highly allocated single malts across more than two centuries of craft. Today, the internationally award-winning Highland distillery, renowned for its tropical house style and innovative distillation process, marks its most significant U.S. expansion yet with the introduction of its 12-Year-Old and 16-Year-Old Single Malts, offering a refined yet welcoming entry point into its celebrated world of flavor.

“As Fettercairn continues to grow in the U.S., these two releases mark an important step in inviting more whisky drinkers to experience our house style,” said Andrew Kullhem, President of North America for Whyte & Mackay. “They offer a clear expression of our tropical character—bringing together innovation, maturation, and craftsmanship in a way that invites discovery, whether you’re exploring single malt for the first time or deepening an existing appreciation.”

Rooted in more than 200 years of whisky-making expertise, Fettercairn takes a progressive, flavor-led approach that begins with its distinctive new make spirit. Defined by notes of tropical fruit, nutty cereal, and a signature silky mouthfeel with subtle coconut richness, this foundational character is refined by its unique copper cooling ring distillation process. By cascading cool water from the nearby Cairngorm Mountains over the stills, the copper is rapidly cooled, allowing only the lightest vapors to rise and bringing greater precision to how flavor is developed.

The result is a whisky that is vibrant, expressive, and unmistakably Fettercairn—something Distillery Manager Stewart Walker, who has spent over three decades shaping the character of Fettercairn, describes as a balance between purity and craft. “That process gives us a beautifully light, tropical spirit to work with, and from there, it’s about shaping that character with care—preserving its freshness while building texture and complexity through maturation. It’s an imaginative approach to Highland Single Malt Scotch.”

Fettercairn 12-Year-Old | SRP $54.99; 46% ABV; natural color and non-chill filtered

An inviting introduction to the distillery’s signature style, this expression is matured in ex-bourbon American white oak barrels for at least 12 years. The nose opens with vanilla and pear, softened by gentle spice, leading to a palate of nectarine and tropical fruit deepened by notes of roasted coffee, clove, and ginger. The finish lingers on golden raisins and black toffee.

Fettercairn 16-Year-Old | SRP $89.99; 46.4% ABV; natural color and non-chill filtered

Offering greater depth and complexity, this expression is aged for at least 16 years in a combination of first-fill and refill American oak ex-bourbon barrels and hogsheads. Aromas of grilled pineapple, Madagascan vanilla, and sugared almonds give way to a rich palate of tropical fruit, poached pear, and honey. Notes of vanilla, almond, and warming spice carry through to the finish.

“What’s exciting about these two expressions is how they allow the spirit to show itself in different ways,” added Walker. “It’s about revealing new dimensions of that tropical profile over time.”

Both expressions have been recognized by leading authorities, with the 12-Year-Old awarded 93 points by Wine Enthusiast and 92 points by Whisky Advocate, while the 16-Year-Old received 95 points and 93 points, respectively.

The Fettercairn 12-Year and 16-Year-Old Single Malts will be available nationwide through key retailers and leading on-premise destinations.

--

Press Contact: Ashley Lipyansky - Cork + Knife Communications

About Fettercairn

Fettercairn Distillery is a hidden gem – an award-winning Single Malt Scotch Whisky Distillery located in the heart of a thriving agricultural community, Aberdeenshire - ‘The Garden of Scotland’. A spark of whisky-making ingenuity is what makes Fettercairn special. A sense of wonder has been a constant theme back to 1824, as illustrated by our beautiful copper cooling ring, which produces a uniquely tropical style of new make spirit. With over 200 years of expertise, we continue to take a progressive outlook and make new unexpected journeys in flavor-led whisky-making. We invite curious whisky lovers and connoisseurs to explore and enjoy Fettercairn Single Malt.

Award-Winning Whisky Makers Whyte and Mackay

Whyte and Mackay is home to a collection of multi-award-winning Single Malt Whiskies including The Dalmore, Jura and Fettercairn. With a premium spirits portfolio that includes contemporary whisky brands Shackleton, Woodsman and John Barr, alongside popular alcohol brands Wildcat, Fundador, Harveys Bristol Cream and Aperitivo. In the UK, the company produces Whyte & Mackay, an award-winning ever-popular Blended Whisky, which recently launched the market-leading ‘Whyte & Mackay Light’ – a lighter spirit drink from Scotland, bottled at a lower ABV. Founded in Glasgow 1844, the whisky makers celebrated their 175-year anniversary in 2019. Today, Whyte and Mackay have offices from New York to Singapore. In Scotland, Whyte and Mackay operate a state-of-the-art Bottling Hall and Distribution Centre in Grangemouth and a Whisky Production and Warehousing Centre in Invergordon.

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed. Stay Competitive.

Become an Insider to unlock exclusive CPG insights, data, education, and industry exposure for food & beverage leaders.

Industry Analysis

Context behind the headlines

Data & Reports

Category performance & trends

On-Demand Education

Expert-led video courses

Get Insider Access

Already an Insider? Log In


Latest News

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

Taste Radio: When Landing Millions Starts With A ‘FirstLook’

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart

SPONSORED POST
Why the Future of Functional Beverages Is Defined by Consumer Experience

Why the Future of Functional Beverages Is Defined by Consumer Experience

Marketplace

Contract Brewing Available

Contract Brewing Available

View All|Post a Listing

Featured Jobs

Innovation Tech 1 - Sierra Nevada Brewing Co.

Innovation Tech 1 - Sierra Nevada Brewing Co.

Area Sales Manager - St. Pete, FL - Good Boy Vodka

Area Sales Manager - St. Pete, FL - Good Boy Vodka

Wholesale Sales Representative – Specialty Coffee Inventory - Mochalux

Wholesale Sales Representative – Specialty Coffee ...

Brewer - WeldWerks Brewing Co.

Brewer - WeldWerks Brewing Co.

Director of Beverage Co-Packing Sales - MetaBrand LLC

Director of Beverage Co-Packing Sales - MetaBrand ...

Northeast Market Manager – NY/NJ/CT - Social Hour Cocktails

Northeast Market Manager – NY/NJ/CT - Social Hour ...

View All Jobs|Post a Job

More News

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation

New Beverages: Creatine, Protein, Caffeine and Everything In Between

New Beverages: Creatine, Protein, Caffeine and Everything In Between

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Head Brewer | Berkeley, CA - Gilman Brewing Company - Gilman Brewing Company
  • Lead Brewer - Smog City Brewing Co. - Smog City Brewing Co.
  • Cellar Operator - Craftsmith Beverage - Craftsmith Beverage
  • Packaging Operator - Craftsmith Beverage - Craftsmith Beverage
  • Director of Sales – Retail - Coast Beacon - Coast Beacon
  • Brewery Operator - 3rd Shift - New Holland Brewing Co. LLC - New Holland Brewing Co. LLC
  • Packaging Operator - Hopworks Brewery - Hopworks Brewery
View AllPost a Job

Recent Articles

  • Newswire
  • Features
  • Spirits
  • Beer
  1. Kick Fizz Hemp Beverages Now Available Across Texas
  2. Coca-Cola Consolidated Announces New Partnership Bringing Coca-Cola Products to Kiawah Island Golf Resort
  3. Sazerac Company Continues Investing in Kentucky with Acquisition of Garrard County Distilling
  4. Redwood Empire California Whiskey Announces New Limited-Edition: “The Hyperion”
  5. New Riff Re-releases Sherry-Finished Malted Rye
  6. London Welcomes SANE: London's First Dedicated Sake & Wine Bar
  7. VKTRY Protein Launches The Athlete’s Protein Shot Nationwide at GNC
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. Taste Radio: When Landing Millions Starts With A ‘FirstLook’
  3. 7 Brew Goes Beyond the Drive-Thru with Major Coffee, Energy Launch at Walmart
  4. Newtopia Now: Mushrooms And Collagen Headline Beverage Innovation
  5. New Beverages: Creatine, Protein, Caffeine and Everything In Between
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. Distribution: Pretty Tasty Goes National with Target; Real Coco Expands ALDI Set
  1. Gallup: Total Alcohol Drinkers Unchanged from 2025; Adult Non-Alc Trial Picks Up
  2. RTDs Deliver 38% of Bev-Alc Innovation Dollars from Just 22% of Items
  3. Mission Craft Cocktails Rides The Pickle Wave From Prank To New SKU
  4. Diageo Cut 1,900+ Jobs in FY26; 90% of Restructuring to Be Completed by September
  5. YOSHI Is Betting ‘Matchatinis’ Can Repeat Espresso’s Cocktail Success
  6. Sazerac Acquires The UK’s Au Vodka, Adds Another RTD to Portfolio
  7. Adult Non-Alc In 2026: A $1 Billion Category With a Splitting Playbook
  1. Insider’s Week in Beer: The War on Vertical Drinking
  2. Former Stone Escondido Site Faces 220 Cuts as Sapporo Winds Down Brewery’s Operations
  3. Press Clips: Increased Brewery Visits, A New Mexico Hermit-Crabbing and Sierra Nevada Agua Azul Spiked Agave Seltzer
  4. Gallup Poll: Record Low Respondents Believe They ‘Drink Too Much;’ Total Drinkers Unchanged from 2025
  5. Boston Beer CFO Diego Reynoso to Exit; Formal Search Launched for Replacement
  6. Calm Markets, Loud Headlines: Agrowgate Q3 2026 Supply Chain Update
  7. NIQ: RTDs Drive 38% of Bev-Alc Innovation Dollars Despite Fewer Items
View All|Submit News

Promoted PR Posts

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

Circle City Whiskey Co. Celebrates Success as It Expands 50/50 Club Whiskey Program Offering

öl brew Launches the First All-Natural, 50-Calorie Flavored Malt Beverage

öl brew Launches the First All-Natural, 50-Calorie Flavored Malt Beverage

Burke Distributing Renews Partnership with Provi, Pairing More Than 90 Years of Service with Modern Digital Commerce

Burke Distributing Renews Partnership with Provi, Pairing More Than 90 Years of Service with Modern Digital Commerce

Wild Bill’s and Jungle Jim’s International Market Launch Exclusive Banana Cream Soda

Wild Bill’s and Jungle Jim’s International Market Launch Exclusive Banana Cream Soda

New Functional Beverage Company Hits the Ground Running

New Functional Beverage Company Hits the Ground Running

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase