• Nosh
  • Brewbound
  • Taste Radio
  • Nombase
BevNET CPG Media Logo
User Avatar

Subscription:

Sign Out Manage Account
User Avatar

Subscription:

Sign Out Manage Account
Login Become an Insider
Login Become an Insider

Features

  • BevNET Live: June 10+11
  • Award Nominations
  • Jobs
  • Data
  • Distribution
  • Investment
  • Manufacturing
  • Marketing
  • Regulatory & Legal
  • Retail
  • Spirits
  • BevNET Magazine
    Back
    • Latest issue
    • Free Subscription
  • PR
    Back
    • Cannabis Beverages
    • Non-Alcoholic Beverages
    • Spirits Companies
    • Supplements
    • Supplier & Service Provider
  • Supplier News

Resources

  • Submit
    Back
    • Submit News
      Send Our Team Your News
    • Sign Up for Elevator Talk
      Sign Up to Pitch Your Brand
    • Submit Product
      Add Your Product to Our Free Database
    • Spirit Awards 2025
      Submit Your Nominations
    • Buyer’s Guide Listings
      Category-Focused Beverage Listings
  • Events
  • Taste Radio Podcast
  • CPG Week Podcast
  • Nombase
  • Daily Newsletter
    Back
    • Free Sign Up
    • View Archive
  • Advertising & Media Kit
  • Directories
    Back
    • Nombase CPG Directory
      Database of Suppliers & Service Providers
    • Best of Awards
      BevNET’s Annual Industry Awards
    • Spirits Awards
      2024 Industry Awards
    • Industry Buyer’s Guides
      Published in BevNET Magazine
    • Brand Database
      Database of Beverage Companies
    • Marketplace
      Listings for Equipment, Services & More
  • Videos
    Back
    • BevNET Live
      Replay Strategic Business Presentations
    • Elevator Talk
      Watch Emerging Brands Pitch
    • View All Videos
      Presentations, Education & Interviews
  • About
    Back
    • About BevNET
      Who We Are & What We Do
    • Team
      Directory of BevNET Staff
    • Contact Us
      Get in Touch with Our Team
    • Charter Members
      Thank You to Our 1200+ Members!

Account

Login
  • Settings
Become an Insider
logo
  • BevNET Live: June 10+11
  • Best of 2025
  • Jobs
  • Investment
  • Retail
  • Data
  • Spirits
  • Newsletter
  • PR
  • Submit News
logo
Login Become an Insider
Become a BevNET/NOSH Insider Today!
BevNETPress Releases

Pearse Lyons Distillery Launches “The Camino Collection” Single Cask Programme

info_outline PRESS RELEASE posted by Pearse Lyons Distillery

Jul. 23, 2026 at 11:00 am

X LinkedIn Reddit Facebook Email
Report Press Release
pearselyonsdistillery pearseirishwhiskeylexingtonbrewingcoirishwhiskeysinglemaltwhiskeyirishpotstillwhiskeydublinirelandsustainabilityspirits
Spirits Companies
  • image-01

FOR IMMEDIATE RELEASE

July 23, 2026

Pearse Lyons Distillery Launches “The Camino Collection” Single Cask Programme

Limited Edition Irish Single Malt and Irish Pot Still Whiskeys Available at Cask Strength

[DUBLIN, Ireland] July 23, 2026 – Pearse Lyons Distillery, the sixth operating distillery in Ireland’s modern whiskey revival, has announced the release of The Camino Collection, its first-ever single cask whiskey series, celebrating seven generations of Lyons family craftsmanship, the historic St. James's Church, and Ireland's enduring connection to the Camino de Santiago. Featuring individually selected Irish Single Malt and Irish Pot Still whiskeys, each expression is bottled at natural cask strength. Because every cask matures differently, no two releases are ever identical; each bottling is a unique expression shaped by time, wood and craftsmanship. With prices starting from €100, each release reflects the rarity, age and individual maturation journey of the whiskey within.

The Camino de Santiago Connection

The Camino de Santiago, or “Way of St. James,” is a network of ancient pilgrimage routes that lead to the Cathedral of Santiago de Compostela in Spain, where tradition holds that the remains of St. James the Greater are buried. For more than 1,000 years, pilgrims have traveled these routes for religious, spiritual, cultural, and personal reasons. Today, hundreds of thousands of people walk, cycle, or ride portions of the Camino each year, drawn by its rich history and enduring traditions.

Inspired by the Camino de Santiago pilgrimage, The Camino Collection celebrates the idea that every great whiskey tells a story, and every great journey leaves its mark. Like the pilgrims who have travelled the Camino for centuries, every whiskey follows its own path, from grain and fermentation to distillation, maturation and bottling, resulting in a truly one-of-a-kind release.

Pearse Lyons Distillery is housed within the beautifully restored St. James's Church in Dublin's historic Liberties, a place where history and whiskey-making come together. For centuries, the church served as a gathering place for Irish pilgrims beginning their journey to Santiago de Compostela. Today, that legacy lives on through the distillery, where the iconic scallop shell—the enduring symbol of St. James and the Camino—features throughout the building and on every bottle of The Camino Collection.

The Lyons family's connection to whiskey spans seven generations of coopers and distillers. Dr. Pearse Lyons, founder of Pearse Lyons Distillery, represented the sixth generation, while his son, Dr. Mark Lyons, proudly continues that legacy today as the seventh generation, carrying forward the family's passion for craftsmanship, innovation and Irish whiskey.

July 25, 2026 marks both the Feast of St. James the Greater and the ninth anniversary of Pearse Lyons Distillery, making it a fitting date to launch The Camino Collection. The release celebrates the remarkable history of St. James's Church, Ireland's centuries-old connection to the Camino de Santiago, and the continuing story of a family dedicated to whiskey for generations.

The Camino Collection Single Casks

The inaugural collection releases showcase the spirit of innovation established by Dr. Pearse Lyons, celebrating the breadth of the range, the diversity of styles and flavours explored, and the spirit of experimentation that continues to define the distillery's approach to whiskey making. Carefully selected Irish Single Malt and Irish Pot Still whiskeys are each matured in an individual cask and bottled at cask strength in extremely limited quantities.

“The Camino Collection provides a platform for exceptional whiskeys from our inventory that don’t always have a place within our core range, allowing us to share unique and limited offerings that reflect our passion for innovation and craftsmanship.” said Conor Ryan, Head of Production Operations, Pearse Lyons Distillery.

The exclusive whiskeys come from the unique Kentucky Vendome Stills that operated in Carlow (2012-2015) and from 2017 onwards in St. James’s Church. Featuring an original stained-glass neck label showcasing the scallop shell and spire, each bottle represents a distinct chapter in the whiskey’s story—a journey of character and heritage. It is a celebration of tradition and innovation, a piece of history in the making, distilled at the altar of St. James.

The first expressions available to purchase from Pearse Lyons Distillery in Dublin, Ireland and Town Branch Distillery in Lexington, Kentucky are:

  • Irish Pot Still (PS 21-118 0) – Fully matured in Oloroso Hogshead | 59.1% ABV (Available in Ireland)
  • Irish Single Malt (M 19-043 PX) – Fully matured in a Pedro Ximénez Hogshead | 55.6% ABV (Available in Ireland)
  • Irish Single Malt (M 14-C398 KA) – Fully matured in Kentucky Bourbon Barrel Ale Barrels | 54.3% ABV (Available in the USA)

These releases will be closely followed by a series of exclusive single casks, each hand-selected by trusted industry partners who share our passion for Irish whiskey. Following the inaugural bottlings, a limited number of casks will continue to be made available for selection by select partners around the world, while additional unique cask releases will also be unveiled at the distillery as part of the Pearse Irish Whiskey portfolio. As with all single cask expressions, availability will be strictly limited. No two journeys are the same. Every cask tells its own story.

About Pearse Lyons Distillery:

Pearse Lyons Distillery is Dublin’s only independently family-owned distillery, located in the former St. James Church in the heart of the iconic Liberties district. This award-winning boutique distillery produces Pearse Irish Whiskey, Ha’Penny Spirits and other select spirits. Named after the late Dr. Pearse Lyons, a master brewer, whiskey innovator, and founder of global animal health leader. Renovations began with distillation starting in 2012 at its brewery before opening the distillery in 2017. Driven by passion and family tradition, Pearse and his wife Deirdre aimed to create a unique distillery. The Lyons family’s legacy, including five generations of Dublin-based coopers, is honoured here. The distillery’s renowned tours offer an immersive experience in Irish whiskey distillation and the culture of The Liberties. Having retained, for the fourth year, Bord Bia’s Origin Green Gold Member status, the distillery continues to champion sustainability, storytelling, and crafting products with a purpose.

About Pearse Irish Whiskeys:

Pearse Irish Whiskey is a super-premium Irish whiskey brand produced by Pearse Lyons Distillery in Dublin’s historic Liberties district, within the restored walls of the former St. James’s Church. Founded on a vision to create world-class Irish whiskey in the heart of Dublin, the distillery focuses on Irish Single Malt and Single Pot Still expressions, with every whiskey containing its own distillate since beginning distillation in 2012. Since 2021, Pearse Lyons Distillery has further enhanced its commitment to provenance through the use of its own-grown grains from its farm 25km from the distillery, maintaining control of its entire production cycle from field-to-bottle.

About Ha’Penny Spirits:

The Ha’Penny Spirits range was created by a team of craft enthusiasts from Pearse Lyons Distillery, inspired by the iconic Ha’Penny Bridge, a symbol of Dublin's unique and charismatic spirit. Dublin is a city of character and characters, warm, witty, and welcoming in equal measure. This spirit has connected people through the years, just as the Ha’Penny Bridge has united the people of Dublin. Alongside its award-winning Irish whiskeys, the distillery boasts The Gin School at Pearse Lyons Distillery that allows students to develop, distill, bottle and purchase their own personal gin creation.

About the Lexington Brewing & Distilling Co.:

Located in Lexington, Kentucky, Lexington Brewing Co. was originally established in 1890 and revitalized in 1999 by the late Pearse Lyons and his son Mark Lyons, evolving into Lexington Brewing & Distilling Co. with the addition of Town Branch Distillery and Pearse Lyons Distillery. Pearse Lyons was a pioneering Irish entrepreneur and scientist with a master’s degree in brewing and a Ph.D. in yeast fermentation. He also founded Alltech, a global leader in animal health and nutrition. Today, both Alltech and Lexington Brewing & Distilling are led by his son, Mark Lyons, who represents the seventh generation of the Lyons family in the brewing, distilling, and cooperage industry. Lexington Brewing & Distilling is the exclusive importer of Pearse Lyons Distillery, proudly representing the spirits portfolio ranges of Pearse Irish Whiskey, Ha’Penny Spirits and Mil Mediterranean Spirits to the United States.

About Alltech:

Founded in 1980 by Irish entrepreneur and scientist Dr. Pearse Lyons and now led by his son Dr. Mark Lyons, Alltech is a global leader in agriculture, committed to providing smarter and more sustainable solutions. With over 40 years of scientific research backing its work, Alltech offers a diverse range of products and services designed to enhance the health and performance of plants and animals. This, in turn, leads to improved nutrition, reduced environmental impact, and advanced innovation in the field. Alltech's portfolio includes specialty ingredients, premix supplements, feed, and biologicals, all underpinned by a strong scientific foundation and a commitment to adaptability. As a private, family-owned company, Alltech emphasizes quick responses to customer needs and fosters a unique, entrepreneurial culture. Headquartered near Lexington, Kentucky, Alltech operates in over 120 countries with five bioscience centers and more than 80 manufacturing facilities worldwide. Their mission, encapsulated in their purpose of “Working Together for a Planet of Plenty™,” focuses on providing nutrition for all, revitalizing local economies, and replenishing the planet’s natural resources.

# # #

For More Information:
Learn More

BevNET & Nosh Insider

Stay Informed, Stay Competitive

Unlock the articles, expert interviews, and data reports that power the food and beverage industry. Join our community and stay ahead with exclusive insights from BevNET and Nosh.

Get Started

Already an Insider? Log In


Latest News

Christian Energy Drinks are Becoming a Thing. What’s Driving Them?

Christian Energy Drinks are Becoming a Thing. What’s Driving Them?

NIQ: Vodka RTDs Are the Category’s Best Recruitment Tool as Core Sales Slide

NIQ: Vodka RTDs Are the Category’s Best Recruitment Tool as Core Sales Slide

Southern Glazer’s Closes Eagle Rock Colorado Deal

Southern Glazer’s Closes Eagle Rock Colorado Deal

SPONSORED POST
Connecting Benefits with Flavor to Build Trust in Functional Beverages

Connecting Benefits with Flavor to Build Trust in Functional Beverages

Marketplace

Award Winning Beverage Formulation

Award Winning Beverage Formulation

View All|Post a Listing

Featured Jobs

Packaging Manager - Guilford Hall Brewery

Packaging Manager - Guilford Hall Brewery

Field Brand Ambassador - Wilding Brands

Field Brand Ambassador - Wilding Brands

Brand Representative - Miami, FL - Good Boy Vodka

Brand Representative - Miami, FL - Good Boy Vodka

Area Sales Manager - Long Island, NY - Good Boy Vodka

Area Sales Manager - Long Island, NY - Good Boy...

Regional Marketing Coordinator - Good Boy Vodka

Regional Marketing Coordinator - Good Boy Vodka

Assistant Brewer - Lucky Luke Brewing Co

Assistant Brewer - Lucky Luke Brewing Co

View All Jobs|Post a Job

More News

Taste Radio: PepsiCo Is Paying Attention. Are You?

Taste Radio: PepsiCo Is Paying Attention. Are You?

New Beverages: C4, Free Rein Embrace Protein; Califia Goes Bananas

New Beverages: C4, Free Rein Embrace Protein; Califia Goes Bananas

Anheuser-Busch InBev Says Cutwater Is on Track for $1B as Spirits Gain Share

Anheuser-Busch InBev Says Cutwater Is on Track for $1B as Spirits Gain Share

Sprouts Adds 1,300 New Items as Q2 Sales Rise 5% to $2.3B

Sprouts Adds 1,300 New Items as Q2 Sales Rise 5% to $2.3B

Beverage Industry Jobs

Hire or get hired inside the beverage community.

  • Sales Manager- MO, KS & IA - Spiked Ade - Spiked Ade
  • Divisional Vice President - North - good2grow - good2grow
  • Brand Ambassador - SF BAY AREA MARKET - Rupee Beer - Rupee Beer
  • Entry-Level Packaging Member - Fort George Brewery - Fort George Brewery
  • Experienced Packaging Member - Fort George Brewery - Fort George Brewery
  • Field Sales Representative: New York City - Lawson's Finest Liquids - Lawson's Finest Liquids
  • Bourbon Barrel Operations & Client Coordinator - Barrel Global LLC - Barrel Global LLC
View All Post a Job

Recent Articles

  • Features
  • Newswire
  • Spirits
  • Beer
  1. Christian Energy Drinks are Becoming a Thing. What’s Driving Them?
  2. NIQ: Vodka RTDs Are the Category’s Best Recruitment Tool as Core Sales Slide
  3. Southern Glazer’s Closes Eagle Rock Colorado Deal
  4. Taste Radio: PepsiCo Is Paying Attention. Are You?
  5. New Beverages: C4, Free Rein Embrace Protein; Califia Goes Bananas
  6. Anheuser-Busch InBev Says Cutwater Is on Track for $1B as Spirits Gain Share
  7. Sprouts Adds 1,300 New Items as Q2 Sales Rise 5% to $2.3B
  1. This Summer, Suerte Reposado Is the Bourbon Lover’s Vacation Pour
  2. Twitch Phenom Cinna Declares for Bang Energy During Record-Breaking Subathon Attempt
  3. See the Elephant Amaro Lands 99 Fine Wine & Good Spirits Stores Across Pennsylvania
  4. Noblewood USA and Southern Glazer’s Wine & Spirits Announce Strategic Distribution Agreement Across 38 States
  5. Welch's Craft Cocktails Expands The Family
  6. Good Game by T-Pain Expands Circle K Florida Distribution as Retail Momentum Accelerates
  7. RFI Ingredients Accelerates Global Growth Through Strategic Partnership with Astanor
  1. NIQ: Vodka RTDs Are the Category’s Best Recruitment Tool as Core Sales Slide
  2. Anheuser-Busch InBev Says Cutwater Is on Track for $1B as Spirits Gain Share
  3. Suppliers Face Steep Losses as RNDC Enters Chapter 11
  4. Brown-Forman Shuts Down Sazerac Bid Again
  5. RNDC Files For Chapter 11 Bankruptcy
  6. NIQ: As Margarita Sales Cool, Martinis Step Into Spotlight
  7. Zero Proof Playbook: Jill Sites On How To Find Growth In Adult Non-Alc
  1. Now Hiring: Mayor of the Champagne of Beers
  2. Bars Scored Some of Their Most Valuable Days During the World Cup, per NIQ Report
  3. Press Clips: Director of Marketing Jeff Pillet-Shore Leaves Allagash; BA Details Section 301 Tariffs Impact
  4. NIQ: Vodka RTD Growth Shows Where Spirits Innovation is Converting
  5. Constellation Only Top 5 Beer Vendor in Growth in L4W, per Circana Monthly Report
  6. Southern Glazer’s Completes Eagle Rock Colorado Acquisition; Appoints A-B Vet as GM
  7. A-B CEO: ‘We are the Competition’ in Spirits; World Cup Benefits to Last Beyond 2026
View All|Submit News

Promoted PR Posts

Recoup, the First Regenerative Organic Certified Hydration Beverage, Refreshes Brand, Formula, and Packaging

Recoup, the First Regenerative Organic Certified Hydration Beverage, Refreshes Brand, Formula, and Packaging

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Chameleon Coffee Launches Organic A2 Flash Brew RTD Coffee Exclusively at Sprouts Farmers Market

Creator-Led Beverage Brand JAZ Energy Sells Out Second Flavor as Founders Prepare Third Launch

Creator-Led Beverage Brand JAZ Energy Sells Out Second Flavor as Founders Prepare Third Launch

PLAYR1 Partners with K-12 Food Solutions to Bring MAD Science-Based Multi-Functional Beverages to Schools

PLAYR1 Partners with K-12 Food Solutions to Bring MAD Science-Based Multi-Functional Beverages to Schools

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

Skip Shapiro Enterprises Launches Specialized Website for Beverage Destruction and Sustainable Waste Management

A Simpler Cola. (Real Cane Sugar, Just Less of It.)

A Simpler Cola. (Real Cane Sugar, Just Less of It.)

View All|Post a PR
BevNET.com

Contact

  • Advertise / Media Kit
  • Event Sponsorship
  • About Us
  • Contact Us
  • Submit News
  • Submit Product

Follow

  • Newsletter
  • Facebook
  • Twitter
  • Instagram
  • YouTube

Resources

  • BevNET
  • BevNET Live
  • BevNET Magazine
  • Taste Radio Podcast
  • NOSH
  • Brewbound
  • Nombase

Navigate

  • Beverage News
  • Magazine
  • Free Newsletter
  • Industry Events
  • Beverage Jobs
BevNET CPG Media Logo

BevNET is a part of BevNET CPG Media. All rights reserved (Terms & Privacy Policy) © 2016 - 2026.

  • BevNET
  • Nosh
  • Brewbound
  • Taste Radio
  • Nombase
An error has occurred. This application may no longer respond until reloaded. Reload 🗙